
This podcast is an experiment to find a different outlet for my short stories as short audiobooks, as well as finding a way to combine my love of mixing and editing audio with presenting. It's self-hosted, carries no advertising, no sponsorship and is just for fun. I also welcome occasional guest authors.
No generative AI is used in any part of the writing, recording, mixing or creation of any artwork for this podcast.
Giles Booth was born in Bristol and grew up in North Somerset. He’s a former teacher and BBC radio sound engineer. He enjoys reading and writing short fiction. His 2008 novella for young adults Constance Breakwater and her Beautiful Museumhood is available as an eBook and paperback.
Apologies for restoring Spotify player embeds in place of Apple ones - Apple's embeds don't support audio hosted on sites without HTTPS, even though their podcast app does. Shrug emoji.
Enter the world of The Mind Children, an alien race who visted Earth in a 1979 children's TV series that has been forgotten and almost completely erased.
It was written and mixed by Giles Booth and features original music by the British composer Lee Sparey. Text and audio mix ©2026 Giles Booth.
Bob and Dave are the only people who remember a lost 1970s children's TV show called The Mind Children. Reconnected after forty years by social media, the childhood friends start to investigate why it was cancelled after only three episodes, and what happened to its elusive creator.
Bob and Dave explore episode two of The Mind Children TV show, which tackled the subject of abuse at a boarding school. Then a listener contacts Dave with some extraordinary information about the series' enigmatic creator.
Dave is contacted by a listener and drives to deepest Somerset on the trail of the elusive creator of The Mind Children.
The Mind Children are back! Bob and Dave get their hands on a typescript of the unbroadcast final three episodes. In episode 4 The Mind Children conduct an experiment in social and mental engineering at the school Christmas fair.
The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIOGAMDCOPDTZCFQYSGZOFAYOMEIAMKKFBGFQKOZTCNUKSNZOCAMEEFXDTPTZCFHTFLLTZOCKQWKNKEMZQGYKORFTGVCAGKYQKENRNHMPORBLHRCFFPPCGQAGPGPLAHMNOSCFCPSGECKNYSGKLCNMKCNMNTIKISKEEFDQNISNDQZOCKPFPLACQDQFQFAKYKGA
The Mind Children unexpectedly take the side of a school bully, and Bob and Dave get closer to cracking the code that will unlock the mystery of what happened to the forgotten TV show’s author.
TOMORROW NEVER KNOWS is a new Listen with Other story in six parts, published (approximately) weekly starting on 16th April 2026.
Enter the world of Kim, who lives above a bookshop and dreams of a time when rationing will end. She longs to know more about the past events that made the world like it is, why strange graffiti keeps appearing on the bookshop, and discover more about her grandfather who lives in a castle in a nearby island.
Tomorrow Never Knows was written and mixed by Giles Booth and features original music by Lee Sparey. ©2026 Giles Booth.
Kim never knew her mother. She lives above the town bookshop with her father, dreaming of a time when rationing will end. When her father is called away, she is on the cusp of discovering more about her family, and the world around her.
Kim arrives on the island, meets her grandfather who lives in the castle, and discovers the place is not quite as welcoming as she remembered it.
As Kim's stay on the island is extended she makes friends with two children who help her understand more about what's really going on, on the island and beyond.
Roland helps Kim hatch a plan to escape the island using an ancient path across the mud.
It's Kim's birthday and Roland has an unusual gift for her.
As the big vote approaches, Kim makes a discovery about her family.
Andrew takes a short lease on a cottage in west Cornwall to help him get over the death of his wife. In the small fishing village he meets the curator of an eccentric museum and Andrew becomes obsessed with the jewel in the crown of its collection.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
The cover art for episode 1 is based a cartoon from Fun magazine, 2nd September 1865, page 155 entitled 'Buoyed with Hope, Puck laments the broken girdle' via Hathi Trust / University of Minnesota, public domain.
Andrew arrives in the fishing village of Poljizal and meets the museum's curator.
Andrew meets the caretaker and volunteers to help catalogue the museum's rambling collection.
Becoming increasingly obsessed with the museum's star exhbit, Andrew has a breakthrough.
Go back in time to the early 2000s when the staff of a tiny British computer company are struggling to produce a new personal digital assistant called the MagicSlate. Join these four conflicting forces on a team-building exercise which has unintended consequences in every direction. Written, read and mixed by Giles Booth. Incidental music in episodes 2 and 3 by Lee Sparey.
It's Facilitator of the Year 2003 Ken Carter's final day at Motivate! What will the day hold for him and his final delegates?
The four colleagues face their first team-building challenge of the day: work together to navigate a swamp.
Tempers fray as the four colleagues are split into two teams to embark on a treasure hunt.
Series five of Listen with Other welcomes a guest author: Ray Newman, author of Municipal Gothic and Intervals of Darkness, who reads his new story: The Interchange.
Nobody knows who built the new exit road at Old Barn roundabout near the motorway interchange, when, or why. What is certain is that anybody who drives that way disappears. Every attempt by the authorities to investigate only raises more questions, and suggests new and more sinister possibilities.
The Interchange features original music and location recording made by the author. This story will be included in Ray's forthcoming collection Thin Places in Hard Concrete, due in spring 2026. Find out more about the author at his website https://precastreinforced.co.uk
Enter the world of an enigmatic academic, hidden at the top of a dilapidated brutalist concrete university tower, a professor of paranormal computing, looking for patterns in random noise, and debunking stories of the unexplained.
A persistent podcast researcher interrupts their near-solitude, leading to an investigation of a legend surrounding the fate of any student unlucky enough to be assigned room 623.
This is an adaptation of a story I wrote in 2022.
Content warning: each episode contains references to suicide.
We meet the professor of paranormal computing at the University of Lowlands. Their name? Their name is not important.
The professor goes in search of the real room 623.
The professor gets a wrong number. Is it a prank - or something more sinister?
Listen with Other is back with a new short story for the new year - and a new arrangement of the sig tune. Join me in two episodes to discover how 1970s family Ouija board sessions come back to haunt our narrator in the present day.
Half of this story is true - but which half?
Our narrator starts to tell the story of a perfectly normal Seventies family séance... then becomes aware that he is not quite where he wants to be.
Two strangers attempt to unravel the mystery of the Ring O'Bells.
This is a new audio book adaptation of a Christmas short story I wrote in 2014, inspired by two possibly unlikely bedfellows, Alan Garner and the late Shirley Hughes.
Lucy and Tom reluctantly go away for Christmas with their dad and his girlfriend.
Lucy and Tom's first day in the cottage takes a strange turn.
Lucy and Tom explore a strange room in the loft.
Christmas Day does not quite go to plan.
A young couple in London take a New Year break in Somerset, unaware of strange forces triangulating their lives.
Kate's birthday fell just after new year so it was always a struggle finding people in the mood to party. Hoping to exorcise the memory of a disastrous birthday party five years ago, her husband lan books a getaway in rural Somerset. Unfinished business with Margate Louise, a friend they lost touch with, a storm called Arthur and a stone circle that is not what it seems, ensure that this new year and birthday do not go to plan...
An unexpected visitor interrupts Kate and Ian's getaway.
The trio meet some merry milkmaids and have a life-changing experience.
Many thanks to Ray Newman for the episode photographs of the Stanton Drew stone circle.
Listen with Other is a GSB Radio Enterprises production.
© 2025-6 Giles Booth.